discontinued

AP42219PU-N ZNF207 antibody

See related secondary antibodies

Search for all "ZNF207"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Rat ZNF207

Product Description for ZNF207

Rabbit anti Bovine, Canine, Human, Mouse, Rat ZNF207.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF207

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms Zinc finger protein 207
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
O43670
Immunogen:
The immunogen for anti-ZNF207 antibody: synthetic peptide directed towards the middle region of human ZNF207
AA Sequence:
QAQAVSAPGILNRPPAPTATVPAPQPPVTKPLFPSAGQMGTPVTSSSTA
GeneID:
7756
Application

Western blotting (0.5 - 2 µg/ml)

Background ZNF207 is a 478 amino acid 50 kDa protein containing 2 C2H2-type zink fingers. It may be involved in transcriptional regulation. It is ubiquitously expressed.
General Readings Pahl,P.M., et al., (1998) Genomics 53 (3), 410-412
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Dog, Mouse, Rat, Bovine
Species reactivity (tested):
Human
Gene ID 7756

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF207 (5 products)

Catalog No. Species Pres. Purity   Source  

ZNF207 (transcript variant 3)

ZNF207 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ZNF207

ZNF207 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF207

ZNF207 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF207

ZNF207 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ZNF207

ZNF207 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn