discontinued

AP42220PU-N ZNF426 antibody

See related secondary antibodies

Search for all "ZNF426"

Quick Overview

Rabbit anti Human, Mouse, Rat ZNF426

Product Description for ZNF426

Rabbit anti Human, Mouse, Rat ZNF426.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for ZNF426

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Zinc finger protein 426
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BUY5
Immunogen:
The immunogen for anti-ZNF426 antibody: synthetic peptide directed towards the N terminal of human ZNF426
AA Sequence:
VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWS
GeneID:
79088
Application

Western blotting (0.2 - 1 µg/ml)

Background ZNF426 is a 554 amino acid protein of 63 kDa. It contains 12 C2H2-type zinc fingers and one KRAB domain. ZNF426 may be involved in transcriptional regulation. The gene coding for ZNF426 is located on Chromosome 19.
General Readings Ota,T., et al., (2004) Genet. 36 (1), 40-45
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat
Species reactivity (tested):
Human
Gene ID 79088

Accessory Products

Proteins and/or Positive Controls

Proteins for ZNF426 (3 products)

Catalog No. Species Pres. Purity   Source  

ZNF426 (full length, N-term HIS tag)

ZNF426 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

ZNF426

ZNF426 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZNF426

ZNF426 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZNF426 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF426 293T Cell Transient Overexpression Lysate(Denatured)

ZNF426 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZNF426 Lysate

Western Blot: ZNF426 Lysate [NBL1-18149] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZNF426
  Novus Biologicals Inc.
  • LinkedIn