discontinued

AP42158PU-N REXO4 antibody

See related secondary antibodies

Search for all "REXO4"

Quick Overview

Rabbit anti Human REXO4

Product Description for REXO4

Rabbit anti Human REXO4.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for REXO4

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Exonuclease XPMC2, PMC2, Prevents mitotic catastrophe 2 protein homolog, RNA exonuclease 4, XPMC2H
Presentation Aff - Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZR2
Immunogen:
The immunogen for anti-REXO4 antibody: synthetic peptide directed towards the middle region of human REXO4.
AA Sequence:
PADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEM
GeneID:
57109
Application Western blotting (0.2 - 1.0 µg/ml)
Background The regulation of the quinone reductase (QR) gene as well as other genes involved in detoxification is known to be mediated by an electrophile response element (EpRE). QR gene regulation by the antiestrogen-occupied estrogen receptor (ER) is mediated by the EpRE-containing region of the human QR gene, and the ER is one of the complex of proteins that binds to the EpRE. REXO4 directly binds to the EpRE and interacts with the ER. The activation of QR gene activity by REXO4 is enhanced in the presence of ER beta.
General Readings "Identification and characterization of a novel factor that regulates quinone reductase gene transcriptional activity." Montano M.M., Wittmann B.M., Bianco N.R. J. Biol. Chem. 275:34306-34313(2000)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Human
Gene ID 57109

Accessory Products

Proteins and/or Positive Controls

Proteins for REXO4 (2 products)

Catalog No. Species Pres. Purity   Source  

REXO4

REXO4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

REXO4

REXO4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for REXO4 (1 products)

Catalog No. Species Pres. Purity   Source  

REXO4 overexpression lysate

REXO4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn