discontinued

AP42227PU-N Claudin-17 / CLDN17 antibody

See related secondary antibodies

Search for all "Claudin-17 / CLDN17"

Quick Overview

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat Claudin-17 / CLDN17

AP42227PU-N

More Views

  • AP42227PU-N
  • AP42227PU-N

Product Description for Claudin-17 / CLDN17

Rabbit anti Bovine, Canine, Human, Mouse, Porcine, Rat Claudin-17 / CLDN17.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Claudin-17 / CLDN17

Product Category Primary Antibodies
Quantity 0.1 mg
Synonyms PRO1489, UNQ758
Presentation Aff - Purified
Reactivity Bov, Can, Hu, Ms, Por, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P56750
Immunogen:
The immunogen for anti-CLDN17 antibody: synthetic peptide directed towards the middle region of human CLDN17
AA Sequence:
KQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPA
GeneID:
26285
Application Western blotting (1 - 4 µg/ml)
Immunohistochemsitry on paraffin embedded sections (4 - 8 µg/ml)
Background CLDN17, clustered with CLDN8 at human chromosome 21q22.11, is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
General Readings Katoh,M. and Katoh,M. (2003) Int. J. Mol. Med. 11 (6), 683-689
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using Protein A affinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Pig, Bovine
Species reactivity (tested):
Human
Gene ID 26285

Accessory Products

Proteins and/or Positive Controls

Proteins for Claudin-17 / CLDN17 (2 products)

Catalog No. Species Pres. Purity   Source  

Claudin-17 / CLDN17

Claudin-17 / CLDN17 Human Purified
  Abnova Taiwan Corp.

Claudin-17 / CLDN17

Claudin-17 / CLDN17 Human Purified
  Abnova Taiwan Corp.

Positive controls for Claudin-17 / CLDN17 (2 products)

Catalog No. Species Pres. Purity   Source  

Claudin 17 Lysate

Western Blot: Claudin 17 Lysate [NBL1-09242] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for CLDN17.
  Novus Biologicals Inc.

CLDN17 overexpression lysate

CLDN17 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn