discontinued

AP42133PU-N NFIX antibody

See related secondary antibodies

Search for all "NFIX"

Quick Overview

Rabbit anti Canine, Human, Mouse, Rat, Zebrafish NFIX

AP42133PU-N

More Views

  • AP42133PU-N
  • AP42133PU-N

Product Description for NFIX

Rabbit anti Canine, Human, Mouse, Rat, Zebrafish NFIX.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for NFIX

Product Category Primary Antibodies
Quantity 50 µg
Synonyms CCAAT-box-binding transcription factor, NF-I/X, NF-I/X, NFI-X, Nuclear factor 1 X-type, TGGCA-binding protein
Presentation Aff - Purified
Reactivity Can, Hu, Ms, Rt, Ze
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14938
Immunogen:
The immunogen for anti-NFIX antibody: synthetic peptide directed towards the middle region of human NFIX
AA Sequence:
YFVHTPESGQSDSSNQQGDADIKPLPNGHLSFQDCFVTSGVWNVTELVRV
GeneID:
4784
Application Western blotting (0.2 - 1.0 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)
Background Nuclear factor I (NFI) proteins constitute a family of sequence-specific transcription factors whose functional diversity is generated through transcription from four different genes (NFI-A, NFI-B, NFI-C, and NFI-X), alternative RNA splicing, and protein heterodimerization. NFI-X has divergent functions after binding in promoter or enhancer position. This property, combined with the differential expression of NFI-X, can achieve cell-type specificity of NFI dependent promoters and enhancers.
General Readings Norquay,L.D., et al., (2003) Mol. Endocrinol. 17 (6), 1027-1038
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Dog, Zebrafish
Species reactivity (tested):
Human
Gene ID 4784

Accessory Products

Proteins and/or Positive Controls

Proteins for NFIX (5 products)

Catalog No. Species Pres. Purity   Source  

NFIX

NFIX Human
  Abnova Taiwan Corp.

NFIX

NFIX Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFIX

NFIX Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFIX

NFIX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NFIX

NFIX Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NFIX (2 products)

Catalog No. Species Pres. Purity   Source  

NFIX 293T Cell Transient Overexpression Lysate(Denatured)

NFIX 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NFIX overexpression lysate

NFIX overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn