discontinued

AP42137PU-N Zinc transporter 9 / SLC30A9 antibody

See related secondary antibodies

Search for all "Zinc transporter 9 / SLC30A9"

Quick Overview

Rabbit anti Canine, Human, Porcine Zinc transporter 9 / SLC30A9

Product Description for Zinc transporter 9 / SLC30A9

Rabbit anti Canine, Human, Porcine Zinc transporter 9 / SLC30A9.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for Zinc transporter 9 / SLC30A9

Product Category Primary Antibodies
Quantity 50 µg
Synonyms C4orf1, HUEL, Human embryonic lung protein, Solute carrier family 30 member 9, ZNT-9, ZNT9
Presentation Aff - Purified
Reactivity Can, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6PML9
Immunogen:
The immunogen for anti-SLC30A9 antibody: synthetic peptide directed towards the N terminal of human SLC30A9
AA Sequence:
LSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQV
GeneID:
10463
Application Western blotting (0.2 - 1.0 µg/ml)
Background SLC30A9 also called HUEL includes the putative nuclear receptor interaction motif, nuclear localization and export signals, zinc finger, leucine zipper and acidic domains. HUEL is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation. It plays a role in the p160 coactivator signaling pathway that mediates transcriptional activation by nuclear receptors and in transcriptional activation of Wnt-responsive genes. SCL30A9 is ubiquitously expressed in fetal and adult tissues and cancer cell lines.
General Readings Sim, et al., (2002) Int. J. Biochem. Cell Biol. 34 (5), 487-504
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Pig, Dog
Species reactivity (tested):
Human
Gene ID 10463

Accessory Products

Proteins and/or Positive Controls

Proteins for Zinc transporter 9 / SLC30A9 (2 products)

Catalog No. Species Pres. Purity   Source  

Zinc transporter 9 / SLC30A9

Zinc transporter 9 / SLC30A9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Zinc transporter 9 / SLC30A9

Zinc transporter 9 / SLC30A9 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Zinc transporter 9 / SLC30A9 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC30A9 293T Cell Transient Overexpression Lysate(Denatured)

SLC30A9 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn