discontinued

AP42233PU-N TOX antibody

See related secondary antibodies

Search for all "TOX"

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat TOX

Product Description for TOX

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rat TOX.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for TOX

Product Category Primary Antibodies
Quantity 50 µg
Synonyms KIAA0808, Thymocyte selection-associated high mobility group box protein TOX, Thymus high mobility group box protein TOX
Presentation Aff - Purified
Reactivity Bov, Can, Chk, Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
O94900
Immunogen:
The immunogen for anti-TOX antibody: synthetic peptide directed towards the N terminal of human TOX.
AA Sequence:
CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP
GeneID:
9760
Application

Western blotting (0.2 - 1 µg/ml)

Background Some high-mobility group (HMG) box proteins (e.g., LEF1) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.Some high-mobility group (HMG) box proteins (e.g., LEF1) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1) have multiple HMG boxes and bind DNA in a sequence-independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.[supplied by OMIM].
General Readings Aliahmad,P., (2004) J. Exp. Med. 199 (8), 1089-1099
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Dog, Rat, Bovine, Chicken
Species reactivity (tested):
Human
Gene ID 9760

Accessory Products

Proteins and/or Positive Controls

Proteins for TOX (1 products)

Catalog No. Species Pres. Purity   Source  

TOX

TOX Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for TOX (2 products)

Catalog No. Species Pres. Purity   Source  

thymocyte selection-associated high mobility group box Lysate

Western Blot: thymocyte selection-associated high mobility group box Lysate [NBL1-17200] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TOX
  Novus Biologicals Inc.

TOX overexpression lysate

TOX overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn