discontinued

AP42289PU-N PRICKLE3 antibody

See related secondary antibodies

Search for all "PRICKLE3"

Quick Overview

Rabbit anti Human, Mouse, Rat PRICKLE3

Product Description for PRICKLE3

Rabbit anti Human, Mouse, Rat PRICKLE3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for PRICKLE3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms LIM domain only protein 6, LMO6, PRICKLE-3, Prickle-like protein 3, Triple LIM domain protein 6
Presentation Aff - Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
O43900
Immunogen:
The immunogen for anti-PRICKLE3 antibody: synthetic peptide directed towards the C terminal of human PRICKLE3
AA Sequence:
GAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQSTPRVSFRDPL
GeneID:
4007
Application Western blotting (0.2 - 1 µg/ml)
Background PRICKLE3 also called LIM domain only 6 is a three LIM domain-containing protein. The LIM domain is a cysteine-rich sequence motif that binds zinc atoms to form a specific protein-binding interface for protein-protein interactions.LIM domain only 6 is a three LIM domain-containing protein. The LIM domain is a cysteine-rich sequence motif that binds zinc atoms to form a specific protein-binding interface for protein-protein interactions.
General Readings Olsen,J.V., (2006) Cell 127 (3), 635-648
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat
Species reactivity (tested):
Human
Gene ID 4007

Accessory Products

Proteins and/or Positive Controls

Proteins for PRICKLE3 (2 products)

Catalog No. Species Pres. Purity   Source  

PRICKLE3

PRICKLE3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PRICKLE3

PRICKLE3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn