discontinued

AP42236PU-N SLC17A2 / NPT3 antibody

See related secondary antibodies

Search for all "SLC17A2 / NPT3"

Quick Overview

Rabbit anti Bovine, Human, Mouse SLC17A2 / NPT3

AP42236PU-N

More Views

  • AP42236PU-N

Product Description for SLC17A2 / NPT3

Rabbit anti Bovine, Human, Mouse SLC17A2 / NPT3.
Presentation: Aff - Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for SLC17A2 / NPT3

Product Category Primary Antibodies
Quantity 50 µg
Synonyms Na(+)/PI cotransporter 3, Sodium-dependent phosphate transport protein 3, Sodium/phosphate cotransporter 3, Solute carrier family 17 member 2
Presentation Aff - Purified
Reactivity Bov, Hu, Ms
Applications P, WB
Clonality Polyclonal
Host Rabbit
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Polyclonal Antibodies (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
O00624
Immunogen:
The immunogen for anti-SLC17A2 antibody: synthetic peptide directed towards the middle region of human SLC17A2
AA Sequence:
VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAMVTCLPLWAIF
GeneID:
10246
Application Western blotting (0.2 - 1 µg/ml)
Immunohistochemsitry on paraffin embedded sections (2 - 8 µg/ml)
Background SLC17A2 belongs to the major facilitator superfamily, Sodium/anion cotransporter family, and may be involved in actively transporting phosphate into cells via Na+ cotransport. It is expressed in the small intestine, kidney, spleen and testis. Not detected in fetal brain, bone marrow, and mammary gland.
General Readings "A 1.1-Mb transcript map of the hereditary hemochromatosis locus." Ruddy D.A., Kronmal G.S., Lee V.K., Mintier G.A., Quintana L., Domingo R. Jr., Meyer N.C., Irrinki A., McClelland E.E., Fullan A., Mapa F.A., Moore T., Thomas W., Loeb D.B., Harmon C., Tsuchihashi Z., Wolff R.K., Schatzman R.C., Feder J.N. Genome Res. 7:441-456(1997)
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified using peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Bovine
Species reactivity (tested):
Human
Gene ID 10246

Accessory Products

Proteins and/or Positive Controls

Positive controls for SLC17A2 / NPT3 (1 products)

Catalog No. Species Pres. Purity   Source  

SLC17A2 Lysate

Western Blot: SLC17A2 Lysate [NBL1-16020] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SLC17A2
  Novus Biologicals Inc.
  • LinkedIn