FEZF2 / ZNF312

Product Description for FEZF2 / ZNF312

Rabbit anti Bovine, Canine, Human, Mouse, Rat FEZF2 / ZNF312.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Product Category	Primary Antibodies
Quantity	0.1 mg
Synonyms	FEZL, FKSG36, Fez family zinc finger protein 2, Forebrain embryonic zinc finger-like protein 2, Zinc finger protein 312, Zinc finger protein Fez-like
Presentation	Aff - Purified
Reactivity	Bov, Can, Hu, Ms, Rt
Applications	WB
Clonality	Polyclonal
Host	Rabbit
Shipping to	Worldwide
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies GmbH
Material safety datasheet	MSDS for Polyclonal Antibodies (de)

Immunogen	Swiss Prot Num: Q8TBJ5 Immunogen: The immunogen for anti-ZNF312 antibody: synthetic peptide directed towards the N terminal of human ZNF312. AA Sequence: `MASSASLETMVPPACPRAGASPATSKTLAFSIERIMAKTSEPRAPFEPRP` GeneID: 55079
Application	Western blotting (2 - 4 µg/ml)
Background	FEZF2 or ZNF312 is a transcription repressor and required for the specification of corticospinal motor neurons and other subcerebral projection neurons. It may play a role in layer and neuronal subtype-specific patterning of subcortical projections and axonal fasciculation and controls the development of dendritic arborization and spines of large layer V pyramidal neurons. Furthermore, it may be involved in innate immunity.
General Readings	Hashimoto,H., et al., Mech. Dev. 97 (1-2), 191-195 (2000)
Storage	Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer. Avoid repeated freezing and thawing. Shelf life: one year from despatch.
Format	Purification: Purified using Protein A affinity column State: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Aff - Purified
Species Reactivity	Species reactivity (expected): Mouse, Rat, Dog, Bovine Species reactivity (tested): Human
Gene ID	55079

Catalog No.	Species	Pres.	Purity	Source
TP760125	FEZF2 / ZNF312 (full length, N-term HIS tag)
	Human		> 80 % Preparation: . Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.	E. coli	50 µg / €205.00
					OriGene Technologies, Inc.
H00055079-P01	FEZF2 / ZNF312
	Human	Purified
					Abnova Taiwan Corp.
H00055079-P01-25	FEZF2 / ZNF312
	Human	Purified
					Abnova Taiwan Corp.

Catalog No.	Host	Pres.	React.	Applications
R1364AP	Rabbit IgG (H+L chain) antibody
	Goat	AP	Rb	E, WB
					OriGene Technologies GmbH
R1364B	Rabbit IgG (H+L chain) antibody
	Goat	Biotin	Rb	E, WB
					OriGene Technologies GmbH
R1364F	Rabbit IgG (H+L chain) antibody
	Goat	FITC	Rb	E, ICC/IF, WB
					OriGene Technologies GmbH
R1364HRP	Rabbit IgG (H+L chain) antibody
	Goat	HRP	Rb	E, P, WB
					OriGene Technologies GmbH
R1364T	Rabbit IgG (H+L chain) antibody
	Goat	TRITC	Rb	E, F, ICC/IF
					OriGene Technologies GmbH
R1427R	Rabbit IgG F(ab)2 Fragment (H+L chain) antibody
	Donkey	PE	Rb	F
					OriGene Technologies GmbH
R1458C2	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy2
					OriGene Technologies GmbH
R1458C3	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy3
					OriGene Technologies GmbH
R1458C5	Rabbit IgG (H+L chain, adsorbed) antibody
	Goat	Cy5
					OriGene Technologies GmbH