AR60001PU-N JARID1D (His-tag)

Search for all "JARID1D"

25 µg / €350.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

JARID1D

Product Description for JARID1D

JARID1D.
Presentation: Purified

Properties for JARID1D

Product Category Proteins & Growth Factors
Quantity 25 µg
Synonyms H-Y, HY, HYA, Histocompatibility Y antigen, Histone demethylase JARID1D, Jumonji/ARID domain-containing protein 1D, KDM5D, Lysine-specific demethylase 5D, Protein SmcY, SMCY
Presentation Purified
Molecular weight 33.87 kDa
Source E. coli
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BY66
Purity > 95 % by SDS-PAGE and Silver staining
Add. information mRNA RefSeq: NM_001146705.1
Background H-Y antigen is defined as a male histocompatibility antigen that causes rejection of male skin grafts by female recipients of the same inbred strain of rodents. Male-specific, or H-Y antigen(s), are also detected by cytotoxic T cells and antibodies. H-Y antigen appears to be an integral part of the membrane of most male cells. In addition, H-Y antibodies detect a soluble form of H-Y that is secreted by the testis. The gene (Smcy/SMCY) coding for H-Y antigen detected by T cells has been cloned. It is expressed ubiquitously in male mice and humans, and encodes an epitope that triggers a specific T-cell response in vitro. Additional epitopes coded for by different Y-chromosomal genes are probably required in vivo for the rejection of male grafts by female hosts. The molecular nature of H-Y antigen detected by antibodies on most male cells is not yet known. Testis-secreted, soluble H-Y antigen, however, was found to be identical to Müllerian-inhibiting substance (MIS). MIS cross-reacts with H-Y antibodies and identical findings were obtained for soluble H-Y antigen and MIS, i.e., secretion by testicular Sertoli and, to a lesser degree, ovarian cells, binding to a gonad-specific receptor, induction of gonadal sex reversal in vitro and, in cattle, in vivo. H-Y antisera also detect a molecule or molecules associated with the heterogametic sex in non-mammalian vertebrates.
General Readings
  1. Wolf U, Cytogenet Cell Genet 80:232 (1998). 2. Scott DM et al, J Mol Med (Berl) 75:103 (1997). 3. Müller U, Hum Genet 97(6):701 (1996). 4. Simpson e et al, Annu Rev Immunol 15:39 (1997).
Storage

Prior to reconstitution store at 2-8°C.
Following reconstitution store undiluted at 2-8°C for one month
or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.

Description
Description:
Recombinant human JARID1D
Result by N-terminal sequencing: ALLVALQRLPVRLP
AA Sequence:
ALLVALQRLPVRLPEGEALQCLTERAIGWQDRARKALASEDVTALLRQLAELRQQLQAKPRPEEASVYTSATACDP IREGSGNNISKVQGLLENGDSVTSPENMAPGKGSDLELLSSLLPQLTGPVLELPEAIRAPLEELMMEGDLLEVTLD ENHSIWQLLQAGQPPDLDRIRTLLELEKFEHQGSRTRSRALERRRRRQKVDQGRNVENLVQQELQSKRARSSGIMS QVGREEEHYQEKADRENMFLTPSTDHSPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQLLEHHHHHH
Molecular weight:
(301 amino acids)
Format
Buffer System:
50 mM NaP, 300 mM NaCl, pH 8.0
Stabilizers:
None
Purity:
>95% by SDS-PAGE and Silver staining
State:
Lyophilized protein
Purified
Reconstitution:
Restore in PBS or water.
  • LinkedIn