AR60010PU-N Endomucin (His-tag)

Search for all "Endomucin"

20 µg / €460.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Endomucin

Product Description for Endomucin

Endomucin.
Presentation: Purified

Properties for Endomucin

Product Category Proteins & Growth Factors
Quantity 20 µg
Synonyms EMCN, EMCN2, Endomucin-2, Gastric cancer antigen Ga34, MUC14, Mucin-14
Presentation Purified
Molecular weight ~ 18.78 kDa
Source E. coli
Species (Protein) Mouse
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9R0H2
Purity > 95 % by SDS-PAGE & Silver staining
Add. information mRNA RefSeq: NM_001163522.1
Background Endomucin (endothelial sialomucin; also Endomucin-1/2 and Mucin-14) is an 80 - 120 kDa glycoprotein member of the Endomucin family of proteins. It is expressed on endothelial cells and depending upon its glycosylation pattern, can serve as either a pro- or anti-adhesive molecule. Mouse Endomucin precursor is 261 amino acids in length. It is type I transmembrane protein that contains a 170 aa extracellular domain (ECD) (aa 21 - 190) and a 50 aa cytoplasmic region. Three splice variants exist in the ECD. One shows a deletion of aa 91 - 141, a second shows a one aa substitution for aa 91 - 129, and a third shows a one aa substitution for aa 129 - 142. Over aa 21 - 90, mouse Endomucin shares 60% and 30% aa identity with rat and human Endomucin, respectively.
General Readings
  1. Kinoshita M et al, FEBS Lett 499 (1-2): 121 (2001).
  2. Kuhn A, Brachtendorf G, Kurth F, Sonntag M, Samulowitz U, Metze D, et al. Expression of endomucin, a novel endothelial sialomucin, in normal and diseased human skin. J Invest Dermatol. 2002 Dec;119(6):1388-93. PubMed PMID: 12485444.
  3. Matsubara A, Iwama A, Yamazaki S, Furuta C, Hirasawa R, Morita Y, et al. Endomucin, a CD34-like sialomucin, marks hematopoietic stem cells throughout development. J Exp Med. 2005 Dec 5;202(11):1483-92. Epub 2005 Nov 28. PubMed PMID: 16314436. (Free PMC Article available, 6 images available)
  4. Brachtendorf G, Kuhn A, Samulowitz U, Knorr R, Gustafsson E, Potocnik AJ, et al. Early expression of endomucin on endothelium of the mouse embryo and on putative hematopoietic clusters in the dorsal aorta. Dev Dyn. 2001 Nov;222(3):410-9. PubMed PMID: 11747076.
  5. Morgan SM, Samulowitz U, Darley L, Simmons DL, Vestweber D. Biochemical characterization and molecular cloning of a novel endothelial-specific sialomucin. Blood. 1999 Jan 1;93(1):165-75. PubMed PMID: 9864158.
  6. Samulowitz U, Kuhn A, Brachtendorf G, Nawroth R, Braun A, Bankfalvi A, et al. Human endomucin: distribution pattern, expression on high endothelial venules, and decoration with the MECA-79 epitope. Am J Pathol. 2002 May;160(5):1669-81. PubMed PMID: 12000719. (Free PMC Article available, 8 images available)
Storage Prior to reconstitution store at 2-8°C.
Following reconstitution store undiluted at 2-8°C for one month
or (in aliquots) at -20°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant mouse soluble Endomucin.
The sequence corresponds to Glu20 to Ser190. A 6x His-tag is fused to the C-terminal end.
Result by N-terminal sequencing: EDGKDVQND
AA Sequence:
EDGKDVQNDSIPTPAETSTTKASVTIPGIVSVTNPNKPADGTPPEGTTKSDVSQTSLVTTINSLTTPKHEVGTTTE GPLRNESSTMKITVPNTPTSNANSTLPGSQNKTENQSSIRTTEISVTTQLLALPKITATSSASLTTAHTMSLLQDT EDRKIATTPSTTPSYSSTRHHHHHH
Molecular weight:
( Monomer, 178 amino acids)
Format
Buffer System:
10mM NaP, pH 7.0
Stabilizers:
None
Purity:
>95% by SDS-PAGE & Silver staining
State:
Lyophilized protein
Purified
Reconstitution:
Restore in water or PBS to a concentration of not lower than 100 μg/ml.
  • LinkedIn