AR31147PU-N EGF

Search for all "EGF"

0.5 mg / €230.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

EGF

AR31147PU-N

More Views

  • AR31147PU-N
  • AR31147PU-N

Product Description for EGF

EGF.
Presentation: Purified

Properties for EGF

Product Category Proteins & Growth Factors
Quantity 0.5 mg
Synonyms Epidermal growth factor, HOMG4, Pro-epidermal growth factor, URG, Urogastrone
Presentation Purified
Molecular weight 6.35 kDa
Source E. coli
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P01133
Purity > 95 % by SDS-PAGE & silver stain
Background Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGFα, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin-binding EGF-like growth factor (HBEGF), epigen, and the neuregulins (NRG) 1 through 6. Members of the EGF family share a structural motif, the EGF-like domain, which is characterized by three intra-molecular disulfide bonds that are formed by six similarly spaced conserved cysteine residues. All EGF family members are synthesized as type I transmembrane precursor proteins that may contain several EGF domains in the extracellular region. The mature proteins are released from the cell surface by regulated proteolysis. The 1207 amino acid (aa) human EGF precursor contains nine EGF domains and nine LDLR class B repeats. The mature protein consists of 53 aa and is generated by proteolytic excision of the EGF domain proximal to the transmembrane region. Mature human EGF shares 70% aa sequence identity with mature mouse and rat EGF. EGF is present in various body fluids, including blood, milk, urine, saliva, seminal fluid, pancreatic juice, cerebrospinal fluid, and amniotic fluid. Four ErbB (HER) family receptor tyrosine kinases including EGFR/ErbB1, ErbB2, ErbB3 and ErbB4, mediate responses to EGF family members. EGF binds ErbB1 and depending on the context, induces the formation of homodimers or heterodimers containing ErbB2. Biological activities ascribed to EGF include epithelial development, angiogenesis, inhibition of gastric acid secretion, fibroblast proliferation, and colony formation of epidermal cells in culture.
General Readings
  1. Harris RC, Chung E, Coffey RJ. EGF receptor ligands. Exp Cell Res. 2003 Mar 10;284(1):2-13. PubMed PMID: 12648462.
  2. Carpenter G, Cohen S. Epidermal growth factor. J Biol Chem. 1990 May 15;265(14):7709-12. PubMed PMID: 2186024.
  3. Bell GI, Fong NM, Stempien MM, Wormsted MA, Caput D, Ku LL, et al. Human epidermal growth factor precursor: cDNA sequence, expression in vitro and gene organization. Nucleic Acids Res. 1986 Nov 11;14(21):8427-46. PubMed PMID: 3491360. (Free PMC Article available)
  4. Carpenter G, Zendegui JG. Epidermal growth factor, its receptor, and related proteins. Exp Cell Res. 1986 May;164(1):1-10. PubMed PMID: 3007185.
  5. Jorissen RN, Walker F, Pouliot N, Garrett TP, Ward CW, Burgess AW. Epidermal growth factor receptor: mechanisms of activation and signalling. Exp Cell Res. 2003 Mar 10;284(1):31-53. PubMed PMID: 12648464.
  6. Gamett DC, Pearson G, Cerione RA, Friedberg I. Secondary dimerization between members of the epidermal growth factor receptor family. J Biol Chem. 1997 May 2;272(18):12052-6. PubMed PMID: 9115272.
  7. Qian X, LeVea CM, Freeman JK, Dougall WC, Greene MI. Heterodimerization of epidermal growth factor receptor and wild-type or kinase-deficient Neu: a mechanism of interreceptor kinase activation and transphosphorylation. Proc Natl Acad Sci U S A. 1994 Feb 15;91(4):1500-4. PubMed PMID: 7509075. (Free PMC Article available)
  8. Qian X, O'Rourke DM, Fei Z, Zhang HT, Kao CC, Greene MI. Domain-specific interactions between the p185(neu) and epidermal growth factor receptor kinases determine differential signaling outcomes. J Biol Chem. 1999 Jan 8;274(2):574-83. PubMed PMID: 9872991.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Recombinant Human Epidermal Growth Factor (EGF).
AA Sequence:
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKW WELR.
N-terminal Sequence: MNSDSECPLS
Biological activity:
The biological activity was determined by the ability to induce EGF receptor phosphorylation in the A431 tumor cell line [Soler et al, J Chromatography B, 788, 2003] and the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Molecular weight:
(54 amino acids)
Format
Buffer System:
PBS
Preservatives:
None
Stabilizers:
None
Purity:
>95% by SDS-PAGE & silver stain
State:
Sterile, Lyophilized powder.
Purified
Reconstitution:
A quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml. 
This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.
  • LinkedIn