AR31159PU-N CD70

Search for all "CD70"

50 µg / €330.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

CD70

AR31159PU-N

Product Description for CD70

CD70.
Presentation: Purified

Properties for CD70

Product Category Proteins & Growth Factors
Quantity 50 µg
Synonyms CD27 ligand, CD27L, CD27LG, TNFSF7, Tumor necrosis factor ligand superfamily member 7
Presentation Purified
Reactivity Hu, Ms
Molecular weight 18.8 kDa
Source CHO cells
Species (Protein) Human
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P32970
Purity > 95 % by SDS-PAGE & HPLC analysis
Add. information Centrifuge vials before opening!
Background CD27 Ligand, a type II transmembrane protein, is a member of the TNF superfamily. It is expressed on activated T and B lymphocytes as well as NK cells. CD27L and its receptor (CD27) regulate the immune response by promoting T-cell expansion and differentiation, as well as NK enhancement. CD27 signaling can act as a co-stimulatory effector to sustain the survival of CD8+ T cells, primarily by inducing increased expression of the IL-2 gene. Full length human CD27L is a 193 amino acid protein, consisting of a 17 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 155 amino acid extracellular domain. Human soluble CD27L corresponds to the 155 amino acid extracellular domain of the full length CD27L protein. The provided human sCD27L protein contains the extracellular domain plus an N-terminal His-Tag.
General Readings
  1. Croft M. The role of TNF superfamily members in T-cell function and diseases. Nat Rev Immunol. 2009 Apr;9(4):271-85. doi: 10.1038/nri2526. PubMed PMID: 19319144. (Free PMC Article available, 4 images available)
  2. Nolte MA, van Olffen RW, van Gisbergen KP, van Lier RA. Timing and tuning of CD27-CD70 interactions: the impact of signal strength in setting the balance between adaptive responses and immunopathology. Immunol Rev. 2009 May;229(1):216-31. doi: 10.1111/j.1600-065X.2009.00774.x. PubMed PMID: 19426224.
  3. Goodwin RG, Alderson MR, Smith CA, Armitage RJ, VandenBos T, Jerzy R, et al. Molecular and biological characterization of a ligand for CD27 defines a new family of cytokines with homology to tumor necrosis factor. Cell. 1993 May 7;73(3):447-56. PubMed PMID: 8387892.
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Description
Description:
Human soluble CD27L corresponds to the 155 amino acid extracellular domain of the full length CD27L protein. The provided human sCD27L protein contains the extracellular domain plus an N-terminal His-Tag.
AA Sequence:
HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPR LYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASR HHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLT GTLLPSRNTDETFFGVQWVRP
Biological activity:
Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml.
Note: Results may vary with PBMC donors.
Molecular weight:
(155 amino acids)
Format
Buffer System:
PBS without stabilizers
Purity:
>95% by SDS-PAGE & HPLC analysis
State:
Lyophilized purified protein
Purified
Reconstitution:
We recommended a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml.
This solution can be diluted into other aqueous buffers and stored at 4°C for one week or at –20°C for future use.
  • LinkedIn