Neuropeptide Y / NPY - AR31131PU-N | acris-antibodies.com

Product Description for Neuropeptide Y / NPY

Neuropeptide Y / NPY.

Immunogen	Swiss Prot Num: P01303
Purity	> 95 % by HPLC
Background	Neuropeptide Y is one of the most abundant neuropeptides in the brain. NPY is a highly potent neurotransmitter in reproductive endocrine functions. Furthermore, neuropeptide Y is involved in endocrine functions regulating stress, metabolism, and eating behavior. Studies on the role of the peptide in appetite and body weight control showed that neuropeptide Y is one of the most potent orexigenic peptides.
General Readings	Minth CD, Bloom SR, Polak JM, Dixon JE. Cloning, characterization, and DNA sequence of a human cDNA encoding neuropeptide tyrosine. Proc Natl Acad Sci U S A. 1984 Jul;81(14):4577-81. PubMed PMID: 6589611. (Free PMC Article available)
Storage	Upon receipt, store undiluted (in aliquots) at -20°C. Avoid repeated freezing and thawing. Shelf life: One year from despatch.
Description	Description: Neuropeptide Y (Human, Rat). Formula: C₁₈₉H₂₈₅N₅₅O₅₇S AA Sequence: `YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-CONH2 (1-Letter code). H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2 (3-Letter code).`
Format	Purity: >95% by HPLC State: Purified peptide