(Pro3) Gastric inhibitory polypeptide - AR31125PU-S

Product Description for (Pro3) Gastric inhibitory polypeptide

(Pro3) Gastric inhibitory polypeptide.

Product Category	Proteins & Growth Factors
Quantity	0.1 mg
Synonyms	GIP, Glucose-dependent insulinotropic polypeptide
Molecular weight	4951.57 Da
Species (Protein)	Human
Shipping to	Worldwide
PDF datasheet	View Datasheet
Manufacturer	OriGene Technologies GmbH
Material safety datasheet	MSDS for Proteins (de)

Immunogen	Swiss Prot Num: P09681
Purity	> 95 % by HPLC
Application	Bioactivity
Background	The gastric inhibitory peptide (GIP) is a potent stimulator of insulin secretion and poor inhibitor of gastric acid secretion.
Storage	Upon receipt, store undiluted (in aliquots) at -20°C. Avoid repeated freezing and thawing. Shelf life: One year from despatch.
Description	Description: Human (Pro3) Gastric Inhibitory Peptide (GIP). Formula: C₂₂₆H₃₃₈N₆₀O₆₆S AA Sequence: `YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH (1-letter code). Tyr-Ala-Pro-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH (3-letter code).`
Format	Purity: >95% by HPLC State: Purified peptide