AR31126PU-S Corticoliberin

Search for all "Corticoliberin"

0.1 mg / €180.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Corticoliberin

AR31126PU-S

Product Description for Corticoliberin

Corticoliberin.

Properties for Corticoliberin

Product Category Proteins & Growth Factors
Quantity 0.1 mg
Synonyms CRF, CRH, Corticotropin-Releasing Factor, Corticotropin-Releasing Hormone
Molecular weight 4757.43 Da
Species (Protein) Human, Rat
Shipping to Worldwide
PDF datasheet View Datasheet
Manufacturer OriGene Technologies GmbH
Material safety datasheet MSDS for Proteins (de)

Datasheet Extract

Immunogen
Swiss Prot Num:
P06850
Purity > 95 % by HPLC
Background Corticotropin-releasing hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in this protein has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta it is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of the hormone occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, this protein may act as a trigger for parturition. [provided by RefSeq, Apr 2010]. 
CRF is a hypothalamic peptide that releases ACTH and endorphin from the anterior pituitary. It is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.
Storage Upon receipt, store undiluted (in aliquots) at -20°C.
Avoid repeated freezing and thawing.
Shelf life: One year from despatch.
Description
Description:
Human, Rat Corticotropin Releasing Factor.
Formula: C208H344N60O63S2
AA Sequence:
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 (1-letter code).
Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Ala-Arg-Ala-Glu-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Glu-Ile-Ile-NH2 (3-letter code).
Format
Purity:
>95% by HPLC
State:
Purified peptide
  • LinkedIn