TA329792 C16orf73 antibody

Rabbit polyclonal Anti-C16orf73 Antibody

See related secondary antibodies

Search for all "C16orf73"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human C16orf73

Product Description for C16orf73

Rabbit anti Human C16orf73.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C16orf73

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Uncharacterized protein C16orf73
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8N635
Immunogen:
The immunogen for anti-C16orf73 antibody: synthetic peptide directed towards the middle region of human C16orf73. Synthetic peptide located within the following region: CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH.
GeneID:
254528
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for C16orf73 (2 products)

Catalog No. Species Pres. Purity   Source  

MEIOB overexpression lysate

MEIOB overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

MEIOB overexpression lysate

MEIOB overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn