TA329993 TBX22 antibody

Rabbit Polyclonal Anti-Tbx22 Antibody

See related secondary antibodies

Search for all "TBX22"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse TBX22

Product Description for TBX22

Rabbit anti Mouse TBX22.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TBX22

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms T-box protein 22, T-box transcription factor TBX22, TBOX22
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8K402
Immunogen:
The immunogen for anti-Tbx22 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SVEALMGRPSKRKAQDPREEMQPELQEEQFVEEGEEILRSPSRDSQQPEK.
GeneID:
245572
Application WB
Background Tbx22 is a probable transcriptiol regulator involved in developmental processes. This is major determint crucial to palatogenesis.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn