TA329999 Serotonin receptor 7 (HTR7) antibody

Rabbit Polyclonal Anti-HTR7 Antibody

See related secondary antibodies

Search for all "Serotonin receptor 7 (HTR7)"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Serotonin receptor 7 (HTR7)

Product Description for Serotonin receptor 7 (HTR7)

Rabbit anti Human Serotonin receptor 7 (HTR7).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Serotonin receptor 7 (HTR7)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 5-HT-7, 5-hydroxytryptamine receptor 7, 5HT7
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P34969
Immunogen:
The immunogen for anti-HTR7 antibody: synthetic peptide directed towards the N terminal of human HTR7. Synthetic peptide located within the following region: HLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTI.
GeneID:
3363
Application WB
Background This is one of the several different receptors for 5- hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by g proteins that stimulate adenylate cyclase.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Serotonin receptor 7 (HTR7) (5 products)

Catalog No. Species Pres. Purity   Source  

Serotonin receptor 7 (HTR7)

Serotonin receptor 7 (HTR7) Human
  Abnova Taiwan Corp.

Serotonin receptor 7 (HTR7)

Serotonin receptor 7 (HTR7) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Serotonin receptor 7 (HTR7)

Serotonin receptor 7 (HTR7) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Serotonin receptor 7 (HTR7)

Serotonin receptor 7 (HTR7) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Serotonin receptor 7 (HTR7)

Serotonin receptor 7 (HTR7) Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Serotonin receptor 7 (HTR7) (3 products)

Catalog No. Species Pres. Purity   Source  

5HT7 Receptor Lysate

Western Blot: 5HT7 Receptor Lysate [NBL1-11783] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HTR7
  Novus Biologicals Inc.

HTR7 overexpression lysate

HTR7 overexpression lysate
  OriGene Technologies, Inc.

HTR7 overexpression lysate

HTR7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn