TA330038 MYBL1 antibody

Rabbit Polyclonal Anti-MYBL1 Antibody

See related secondary antibodies

Search for all "MYBL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human MYBL1

Product Description for MYBL1

Rabbit anti Human MYBL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for MYBL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AMYB, Myb-like protein 1, Myb-related protein A, a-Myb
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P10243
Immunogen:
The immunogen for anti-MYBL1 antibody: synthetic peptide directed towards the C terminal of human MYBL1. Synthetic peptide located within the following region: RCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVKLEKNLQSNCEWETVVY.
GeneID:
4603
Application WB
Background MYBL1 is strong transcriptiol activator; D-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. It could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for MYBL1 (2 products)

Catalog No. Species Pres. Purity   Source  

MYBL1

MYBL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

MYBL1

MYBL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn