TA330085 NFIC antibody

Rabbit Polyclonal Anti-NFIC Antibody

See related secondary antibodies

Search for all "NFIC"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NFIC

Product Description for NFIC

Rabbit anti Human NFIC.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NFIC

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CCAAT-box-binding transcription factor, NF-I/C, NFI, NFI-C, Nuclear factor 1 C-type, TGGCA-binding protein
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P08651
Immunogen:
The immunogen for anti-NFIC antibody: synthetic peptide directed towards the C terminal of human NFIC. Synthetic peptide located within the following region: VRERDAEQSGSPRTGMGSDQEDSKPITLDTTDFQESFVTSGVFSVTELIQ.
GeneID:
4782
Application WB
Background Brg- or hBrm-associated factor (BAF) complexes, a chromatin-remodeling complex family of mammalian cells, facilitate transcriptiol activity by remodeling nucleosome structure. Brg1 is the core subunit of Brg-associated factor complexes. BAF complexes can interact with NF1/CTF and RP II, and this interaction is closely dependent on the activation of gene transcription.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NFIC (6 products)

Catalog No. Species Pres. Purity   Source  

NFIC (transcript variant 1)

NFIC Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NFIC

NFIC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFIC

NFIC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFIC

NFIC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFIC

NFIC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NFIC

NFIC Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NFIC (1 products)

Catalog No. Species Pres. Purity   Source  

NFIC 293T Cell Transient Overexpression Lysate(Denatured)

NFIC 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn