TA330112 FLI1 antibody

Rabbit Polyclonal Anti-FLI1 Antibody

See related secondary antibodies

Search for all "FLI1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human FLI1

TA330112

More Views

  • TA330112

Product Description for FLI1

Rabbit anti Human FLI1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for FLI1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ERGB transcription factor, Fli-1 proto-oncogene, Friend leukemia integration 1 transcription factor, vascular tumor marker
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q01543
Immunogen:
The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the middle region of human FLI1. Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP.
GeneID:
2313
Application WB
IHC
Background Friend leukemia integration 1 (Fli-1) is a member of the ETS family of transcriptiol regulatory proteins that contain a highly conserved and structurally unique D binding ETS domain.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FLI1 (3 products)

Catalog No. Species Pres. Purity   Source  

FLI1

FLI1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FLI1

FLI1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FLI1

FLI1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FLI1 (1 products)

Catalog No. Species Pres. Purity   Source  

FLI1 Lysate

Western Blot: FLI1 Lysate [NBL1-10748] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FLI1
  Novus Biologicals Inc.
  • LinkedIn