TA330113 LHX2 antibody

Rabbit Polyclonal Anti-LHX2 Antibody

See related secondary antibodies

Search for all "LHX2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LHX2

Product Description for LHX2

Rabbit anti Human LHX2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LHX2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein LH-2, LH2, LHX2, LIM homeobox protein 2, LIM/homeobox protein Lhx2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P50458
Immunogen:
The immunogen for anti-LHX2 antibody: synthetic peptide directed towards the middle region of human LHX2. Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA.
GeneID:
9355
Application WB
Background LHX2 is a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptiol regulator. The protein can recapitulate or rescue phenotypes in Drosophila caused by a related protein, suggesting conservation of function during evolution.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LHX2 (5 products)

Catalog No. Species Pres. Purity   Source  

LHX2 (N-term HIS tag)

LHX2 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

LHX2

LHX2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LHX2

LHX2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

LHX2

LHX2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

LHX2

LHX2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for LHX2 (1 products)

Catalog No. Species Pres. Purity   Source  

LHX2 Lysate

Western Blot: LHX2 Lysate [NBL1-12514] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LHX2
  Novus Biologicals Inc.
  • LinkedIn