TA330118 TEAD1 / TEF1 / TCF13 antibody

Rabbit Polyclonal Anti-TEAD1 Antibody

See related secondary antibodies

Search for all "TEAD1 / TEF1 / TCF13"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TEAD1 / TEF1 / TCF13

Product Description for TEAD1 / TEF1 / TCF13

Rabbit anti Human TEAD1 / TEF1 / TCF13.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TEAD1 / TEF1 / TCF13

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NTEF-1, Protein GT-IIC, TEA domain family member 1, TEAD-1, TEF-1, Transcription factor 13, Transcriptional enhancer factor TEF-1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P28347
Immunogen:
The immunogen for anti-TEAD1 antibody: synthetic peptide directed towards the N terminal of human TEAD1. Synthetic peptide located within the following region: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY.
GeneID:
7003
Application WB
Background This gene encodes a ubiquitous transcriptiol enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptiol repressor. Mutations in this gene cause Sveinsson's chorioretil atrophy. Additiol transcript variants have been described but their full-length tures have not been experimentally verified. [provided by RefSeq, May 2010].
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TEAD1 / TEF1 / TCF13 (2 products)

Catalog No. Species Pres. Purity   Source  

TEAD1 / TEF1 / TCF13

TEAD1 / TEF1 / TCF13 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TEAD1 / TEF1 / TCF13

TEAD1 / TEF1 / TCF13 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn