TA330135 E2F5 antibody

Rabbit Polyclonal Anti-E2F5 Antibody

See related secondary antibodies

Search for all "E2F5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human E2F5

Product Description for E2F5

Rabbit anti Human E2F5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for E2F5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms E2F transcription factor 5, E2F-5, Transcription factor E2F5, p130-binding
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q15329
Immunogen:
The immunogen for anti-E2F5 antibody: synthetic peptide directed towards the N terminal of human E2F5. Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN.
GeneID:
1875
Application WB
Background E2F5 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small D tumor viruses. The E2F proteins contain several evolutiolly conserved domains found in most members of the family. These domains include a D binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein is differentially phosphorylated and is expressed in a wide variety of human tissues. It is more homologous to E2F4, a family member, than to other members. Both this protein and E2F4 interact with tumor suppressor proteins p130 and p107, but not with pRB.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for E2F5 (2 products)

Catalog No. Species Pres. Purity   Source  

E2F5 (transcript variant 1)

E2F5 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

E2F5 (N-term HIS tag, transcript variant 1)

E2F5 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

Positive controls for E2F5 (2 products)

Catalog No. Species Pres. Purity   Source  

E2F5 overexpression lysate

E2F5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

E2F5 overexpression lysate

E2F5 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn