TA330178 Nucleobindin-1 antibody

Rabbit Polyclonal Anti-NUCB1 Antibody

See related secondary antibodies

Search for all "Nucleobindin-1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Nucleobindin-1

Product Description for Nucleobindin-1

Rabbit anti Human Nucleobindin-1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Nucleobindin-1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NUC, NUCB1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02818
Immunogen:
The immunogen for anti-NUCB1 antibody: synthetic peptide directed towards the C terminal of human NUCB1. Synthetic peptide located within the following region: PAAHPEGQLKFHPDTDDVPVPAPAGDQKEVDTSEKKLLERLPEVEVPQHL.
GeneID:
4924
Application WB
Background Nucleobindin, also known as calnuc, participates in Ca2+ storage in the Golgi, as well as in other biological processes that involve D-binding and protein-protein interactions.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Nucleobindin-1 (5 products)

Catalog No. Species Pres. Purity   Source  

Nucleobindin-1

Nucleobindin-1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Nucleobindin-1

Nucleobindin-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Nucleobindin-1

Nucleobindin-1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Nucleobindin-1

Nucleobindin-1 Human Purified 90 % E. coli
  GenWay Biotech Inc.

Nucleobindin-1

Nucleobindin-1 Human Purified 90 % E. coli
  GenWay Biotech Inc.

Positive controls for Nucleobindin-1 (2 products)

Catalog No. Species Pres. Purity   Source  

NUCB1 293T Cell Transient Overexpression Lysate(Denatured)

NUCB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Nucleobindin 1 Lysate

Western Blot: Nucleobindin 1 Lysate [NBL1-13848] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NUCB1
  Novus Biologicals Inc.
  • LinkedIn