TA330188 NT5C3 antibody

Rabbit Polyclonal Anti-NT5C3 Antibody

See related secondary antibodies

Search for all "NT5C3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat, Zebrafish, African clawed frog NT5C3

Product Description for NT5C3

Rabbit anti Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat, Zebrafish, African clawed frog NT5C3.
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for NT5C3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Cytosolic 5'-nucleotidase 3, Cytosolic 5'-nucleotidase III, P5N1, Pyrimidine 5'-nucleotidase 1, UMPH1, Uridine 5'-monophosphate hydrolase 1, p36
Presentation Aff - Purified
Reactivity African clawed frog, Bov, Can, Chk, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H0P0
Immunogen:
The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3.
AA Sequence:
VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII
GeneID:
51251
Application Western blotting (0.2 - 1 µg/ml)
Background Pyrimidine 5-prime-nucleotidase (P5N), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology. Pyrimidine 5-prime-nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology.
General Readings Amici,A., et al., (2002) Genomics Meth. Enzymol. 354,149-159
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Purified on peptide immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (expected):
Mouse, Rat, Zebrafish, Dog, Rabbit, Bovine, Chicken, African clawed frog
Species reactivity (tested):
Human

Accessory Products

Proteins and/or Positive Controls

Proteins for NT5C3 (2 products)

Catalog No. Species Pres. Purity   Source  

NT5C3 (transcript variant 3)

NT5C3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NT5C3 (transcript variant 2)

NT5C3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for NT5C3 (5 products)

Catalog No. Species Pres. Purity   Source  

NT5C3 293T Cell Transient Overexpression Lysate(Denatured)

NT5C3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NT5C3A overexpression lysate

NT5C3A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NT5C3A overexpression lysate

NT5C3A overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

NT5C3 Lysate

Western Blot: NT5C3 Lysate [NBL1-13822] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NT5C3
  Novus Biologicals Inc.

NT5C3 Lysate

Western Blot: NT5C3 Lysate [NBL1-13823] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NT5C3
  Novus Biologicals Inc.
  • LinkedIn