TA330192 ZNF746 antibody

Rabbit Polyclonal Anti-ZNF746 Antibody

See related secondary antibodies

Search for all "ZNF746"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZNF746

TA330192

More Views

  • TA330192

Product Description for ZNF746

Rabbit anti Human ZNF746.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for ZNF746

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PARIS, Parkin-interacting substrate, Zinc finger protein 746
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6NUN9
Immunogen:
The immunogen for anti-ZNF746 antibody: synthetic peptide directed towards the middle region of human ZNF746. Synthetic peptide located within the following region: TGPEGLPYSSPDNGEAILDPSQAPRPFNEPCKYPGRTKGFGHKPGLKKHP.
GeneID:
155061
Application WB
IHC
Background ZNF746 may be involved in transcriptiol regulation.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for ZNF746 (2 products)

Catalog No. Species Pres. Purity   Source  

ZNF746 overexpression lysate

ZNF746 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

ZNF746 overexpression lysate

ZNF746 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn