TA330193 NKX2-3 antibody

Rabbit Polyclonal Anti-NKX2 Antibody

See related secondary antibodies

Search for all "NKX2-3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NKX2-3

Product Description for NKX2-3

Rabbit anti Human NKX2-3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NKX2-3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Homeobox protein Nkx-2.3, NK2 transcription factor related, NKX23, NKX2C, Nkx 2.3, Nkx-2.3, locus 3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TAU0
Immunogen:
The immunogen for anti-NKX2-3 antibody: synthetic peptide directed towards the middle region of human NKX2-3. Synthetic peptide located within the following region: AHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAY.
GeneID:
159296
Application WB
Background NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintence of differentiated tissue functions.NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintence of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM]. Sequence Note: This RefSeq record was created from transcript and genomic sequence data because no single transcript was available for the full length of the gene. The extent of this transcript is supported by orthologous data and transcript alignments.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NKX2-3 (4 products)

Catalog No. Species Pres. Purity   Source  

NKX2-3

NKX2-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NKX2-3

NKX2-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NKX2-3

NKX2-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NKX2-3

NKX2-3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for NKX2-3 (1 products)

Catalog No. Species Pres. Purity   Source  

NKX2 overexpression lysate

NKX2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn