TA330208 OSR1 / ODD antibody

Rabbit Polyclonal Anti-OSR1 Antibody

See related secondary antibodies

Search for all "OSR1 / ODD"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human OSR1 / ODD

Product Description for OSR1 / ODD

Rabbit anti Human OSR1 / ODD.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for OSR1 / ODD

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Protein odd-skipped-related 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TAX0
Immunogen:
The immunogen for Anti-OSR1 antibody is: synthetic peptide directed towards the N-terminal region of Human OSR1. Synthetic peptide located within the following region: PIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP.
GeneID:
130497
Application WB
Background OSR1 is a transcription factor that plays a role in the regulation of embryonic heart and urogenital development.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for OSR1 / ODD (3 products)

Catalog No. Species Pres. Purity   Source  

OSR1 / ODD (full length, N-term HIS tag)

OSR1 / ODD Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

OSR1 / ODD

OSR1 / ODD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

OSR1 / ODD

OSR1 / ODD Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for OSR1 / ODD (2 products)

Catalog No. Species Pres. Purity   Source  

OSR1 Lysate

Western Blot: OSR1 Lysate [NBL1-14003] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for OSR1.
  Novus Biologicals Inc.

OSR1 overexpression lysate

OSR1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn