TA330210 Ah receptor / AhR antibody

Rabbit Polyclonal Anti-AHR Antibody

See related secondary antibodies

Search for all "Ah receptor / AhR"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Ah receptor / AhR

TA330210

More Views

  • TA330210
  • TA330210

Product Description for Ah receptor / AhR

Rabbit anti Human Ah receptor / AhR.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for Ah receptor / AhR

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AHR, Aryl hydrocarbon receptor, BHLHE76
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35869
Immunogen:
The immunogen for anti-AHR antibody: synthetic peptide directed towards the N terminal of human AHR. Synthetic peptide located within the following region: RAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQALNGFVL.
GeneID:
196
Application WB
IHC
Background AHR is a ligand-activated transcription factor involved in the regulation of biological responses to plar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Ah receptor / AhR (5 products)

Catalog No. Species Pres. Purity   Source  

Ah receptor / AhR

Ah receptor / AhR Human
  Abnova Taiwan Corp.

Ah receptor / AhR

Ah receptor / AhR Human Purified
  Abnova Taiwan Corp.

Ah receptor / AhR

Ah receptor / AhR Human Purified
  Abnova Taiwan Corp.

Ah receptor / AhR

Ah receptor / AhR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Ah receptor / AhR

Ah receptor / AhR Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Ah receptor / AhR (2 products)

Catalog No. Species Pres. Purity   Source  

Ah receptor (AhR) Lysate(Denatured)

Ah receptor (AhR) Lysate(Denatured)
  Abnova Taiwan Corp.

Aryl hydrocarbon Receptor Lysate

Western Blot: Aryl hydrocarbon Receptor Lysate [NBL1-07403] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for AHR Protein
  Novus Biologicals Inc.
  • LinkedIn