TA330218 ERF antibody

Rabbit Polyclonal Anti-ERF Antibody

See related secondary antibodies

Search for all "ERF"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ERF

Product Description for ERF

Rabbit anti Human ERF.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ERF

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ETS domain-containing transcription factor ERF, Ets2 repressor factor, PE-2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P50548
Immunogen:
The immunogen for anti-ERF antibody: synthetic peptide directed towards the middle region of human ERF. Synthetic peptide located within the following region: SSSPFKFKLQRPPLGRRQRAAGEKAVAAADKSGGSAGGLAEGAGALAPPP.
GeneID:
2077
Application WB
Background Members of the ETS family of transcription factors, such¡¡as ERF, regulate cell proliferation and differentiation. They share¡¡a highly conserved D-binding domain, the ETS domain, that¡¡recognizes the sequence GGAA/T.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ERF (4 products)

Catalog No. Species Pres. Purity   Source  

ERF

ERF Human Purified
  Abnova Taiwan Corp.

ERF

ERF Human Purified
  Abnova Taiwan Corp.

ERF

ERF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ERF

ERF Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ERF (1 products)

Catalog No. Species Pres. Purity   Source  

ERF Lysate

Western Blot: ERF Lysate [NBL1-10326] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ERF.
  Novus Biologicals Inc.
  • LinkedIn