TA330219 Estrogen-related receptor alpha antibody

Rabbit Polyclonal Anti-Esrra Antibody

See related secondary antibodies

Search for all "Estrogen-related receptor alpha"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse Estrogen-related receptor alpha

Product Description for Estrogen-related receptor alpha

Rabbit anti Mouse Estrogen-related receptor alpha.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Estrogen-related receptor alpha

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ERR1, ESRL1, ESRRA, Estrogen receptor-like 1, NR3B1, Nuclear receptor subfamily 3 group B member 1, Steroid hormone receptor ERR1
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O08580
Immunogen:
The immunogen for anti-Esrra antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKL.
GeneID:
26379
Application WB
Background Esrra binds to an ERR-alpha response element (ERRE) containing a single consensus half-site, 5'-TAGGTCA-3'. It can bind to the medium-chain acyl coenzyme A dehydrogese (MCAD) response element NRRE-1 and may act as an important regulator of MCAD promoter. It binds to the C1 region of the lactoferrin gene promoter. It requires dimerization and the coactivator, PGC-1A, for full activity. The ERRalpha/PGC1alpha complex is a regulator of energy metabolism.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn