TA330220 Estrogen-related receptor beta antibody

Rabbit Polyclonal Anti-ESRRB Antibody

See related secondary antibodies

Search for all "Estrogen-related receptor beta"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse Estrogen-related receptor beta

TA330220

More Views

  • TA330220

Product Description for Estrogen-related receptor beta

Rabbit anti Human, Mouse Estrogen-related receptor beta.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Estrogen-related receptor beta

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ERR beta-2, ERR2, ERRB2, ESRL2, ESRRB, Estrogen receptor-like 2, NR3B2, Nuclear receptor subfamily 3 group B member 2, Steroid hormone receptor ERR2
Presentation Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95718
Immunogen:
The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS.
GeneID:
2103
Application WB
Background ESRRB encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. Sequence Note: The sequence AF094517.1 is from a chimeric clone. Only the ESRRB sequence was propagated into this RefSeq record. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Estrogen-related receptor beta (1 products)

Catalog No. Species Pres. Purity   Source  

Estrogen-related receptor beta

Estrogen-related receptor beta Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Estrogen-related receptor beta (2 products)

Catalog No. Species Pres. Purity   Source  

ESRRB overexpression lysate

ESRRB overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

ESRRB overexpression lysate

ESRRB overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn