TA330221 Estrogen-related receptor gamma antibody

Rabbit Polyclonal Anti-Esrrg Antibody

See related secondary antibodies

Search for all "Estrogen-related receptor gamma"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Rat Estrogen-related receptor gamma

Product Description for Estrogen-related receptor gamma

Rabbit anti Rat Estrogen-related receptor gamma.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Estrogen-related receptor gamma

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ERR gamma-2, ERR3, ERRG2, ESRRG, Estrogen receptor-related protein 3, KIAA0832, NR3B3, Nuclear receptor subfamily 3 group B member 3
Presentation Purified
Reactivity Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62510
Immunogen:
The immunogen for anti-Esrrg antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDI.
GeneID:
360896
Application WB
Background Esrrg is an orphan receptor that acts as transcription activator in the absence of bound ligand. It binds specifically to an estrogen response element and activates reporter genes controlled by estrogen response elements.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn