TA330224 ETV5 / ERM antibody

Rabbit Polyclonal Anti-ETV5 Antibody

See related secondary antibodies

Search for all "ETV5 / ERM"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ETV5 / ERM

Product Description for ETV5 / ERM

Rabbit anti Human ETV5 / ERM.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ETV5 / ERM

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ETS translocation variant 5, Ets-related protein ERM
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P41161
Immunogen:
The immunogen for anti-ETV5 antibody: synthetic peptide directed towards the N terminal of human ETV5. Synthetic peptide located within the following region: AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGA.
GeneID:
2119
Application WB
Background ETV5 Contains 1 ETS D-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventiol PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translatiol modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluron binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kises. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ETV5 / ERM (2 products)

Catalog No. Species Pres. Purity   Source  

ETV5 / ERM

ETV5 / ERM Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ETV5 / ERM

ETV5 / ERM Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ETV5 / ERM (2 products)

Catalog No. Species Pres. Purity   Source  

ERM / Etv5 Lysate

ERM / Etv5 Lysate Cat.-No. AS00100LY-N: Western blot analysis of his-tag ETV5 (arrow) using his tag antibody. 293 cell lysates (2 ug/lane) either nontransfected (Lane 1) or transiently transfected with the ETV5 gene.
  OriGene Technologies GmbH

ERM / Etv5 Lysate

Western Blot: ERM / Etv5 Lysate [NBL1-10361] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ETV5
  Novus Biologicals Inc.
  • LinkedIn