discontinued

TA330225 EVI1 antibody

Rabbit Polyclonal Anti-EVI1 Antibody

See related secondary antibodies

Search for all "EVI1"

Quick Overview

Rabbit anti Human EVI1

TA330225

More Views

  • TA330225

Product Description for EVI1

Rabbit anti Human EVI1.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for EVI1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms EVI-1, Ecotropic virus integration site 1 protein homolog, MDS1 and EVI1 complex locus protein EVI1, MECOM
Presentation Purified
Reactivity Hu
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q03112
Immunogen:
The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the N terminal of human EVI1. Synthetic peptide located within the following region: THPQILPATQDILKALSKHPSVGDNKPVELQPERSSEERPFEKISDQSES.
GeneID:
2122
Application WB
IHC
Background EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for EVI1 (2 products)

Catalog No. Species Pres. Purity   Source  

EVI1

EVI1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

EVI1

EVI1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for EVI1 (3 products)

Catalog No. Species Pres. Purity   Source  

EVI1 Lysate

Western Blot: EVI1 Lysate [NBL1-10364] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for MECOM
  Novus Biologicals Inc.

MECOM overexpression lysate

MECOM overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

MECOM overexpression lysate

MECOM overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn