TA330227 ZUFSP / C6orf113 antibody

Rabbit Polyclonal Anti-C6orf113 Antibody

See related secondary antibodies

Search for all "ZUFSP / C6orf113"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human ZUFSP / C6orf113

Product Description for ZUFSP / C6orf113

Rabbit anti Human ZUFSP / C6orf113.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ZUFSP / C6orf113

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Zinc finger with UFM1-specific peptidase domain protein, chromosome 6 open reading frame 113
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96AP4
Immunogen:
The immunogen for anti-C6orf113 antibody: synthetic peptide directed towards the middle region of human C6orf113. Synthetic peptide located within the following region: RQEIEEFQKLQRQYGLDNSGGYKQQQLRNMEIEVNRGRMPPSEFHRRKAD.
GeneID:
221302
Application WB
Background The exact function of C6orf113 remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ZUFSP / C6orf113 (2 products)

Catalog No. Species Pres. Purity   Source  

ZUFSP / C6orf113

ZUFSP / C6orf113 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ZUFSP / C6orf113

ZUFSP / C6orf113 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ZUFSP / C6orf113 (3 products)

Catalog No. Species Pres. Purity   Source  

C6orf113 293T Cell Transient Overexpression Lysate(Denatured)

C6orf113 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

ZUFSP Lysate

Western Blot: ZUFSP Lysate [NBL1-18276] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ZUFSP
  Novus Biologicals Inc.

ZUFSP overexpression lysate

ZUFSP overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn