TA330301 POLR1C antibody

Rabbit Polyclonal Anti-POLR1C Antibody

See related secondary antibodies

Search for all "POLR1C"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human POLR1C

Product Description for POLR1C

Rabbit anti Human POLR1C.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for POLR1C

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DNA-directed RNA polymerase I subunit C, DNA-directed RNA polymerases I and III 40 kDa polypeptide, DNA-directed RNA polymerases I and III subunit RPAC1, POLR1E, RNA polymerases I and III subunit AC1, RPA39, RPA40, RPC40
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15160
Immunogen:
The immunogen for Anti-POLR1C antibody is: synthetic peptide directed towards the N-terminal region of Human POLR1C. Synthetic peptide located within the following region: VRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA.
GeneID:
9533
Application WB
Background The function of this protein remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for POLR1C (5 products)

Catalog No. Species Pres. Purity   Source  

POLR1C (transcript variant 1)

POLR1C Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

POLR1C (1-349, His-tag)

POLR1C Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

POLR1C (1-349, His-tag)

POLR1C Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

POLR1C

POLR1C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

POLR1C

POLR1C Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for POLR1C (3 products)

Catalog No. Species Pres. Purity   Source  

POLR1C 293T Cell Transient Overexpression Lysate(Denatured)

POLR1C 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

POLR1C Lysate

Western Blot: POLR1C Lysate [NBL1-14575] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for POLR1C
  Novus Biologicals Inc.

POLR1C overexpression lysate

POLR1C overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn