TA330358 Cyclin T1 antibody

Rabbit Polyclonal Anti-CCNT1 Antibody

See related secondary antibodies

Search for all "Cyclin T1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Cyclin T1

TA330358

More Views

  • TA330358
  • TA330358

Product Description for Cyclin T1

Rabbit anti Human Cyclin T1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cyclin T1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CCNT1, CycT1, Cyclin-T, Cyclin-T1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O60563
Immunogen:
The immunogen for anti-CCNT1 antibody: synthetic peptide directed towards the N terminal of human CCNT1. Synthetic peptide located within the following region: EGERKNNNKRWYFTREQLENSPSRRFGVDPDKELSYRQQAANLLQDMGQR.
GeneID:
904
Application WB
Background CCNT1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kises. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordition of each mitotic event. This cyclin tightly associates with CDK9 kise, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kise complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kise partner were also found to be involved in the phosphorylation and regulation of the carboxy-termil domain (CTD) of the largest R polymerase II subunit.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kises. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordition of each mitotic event. This cyclin tightly associates with CDK9 kise, and was found to be a major subunit of the transcription elongation factor p-TEFb. The kise complex containing this cyclin and the elongation factor can interact with, and act as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and was shown to be both necessary and sufficient for full activation of viral transcription. This cyclin and its kise partner were also found to be involved in the phosphorylation and regulation of the carboxy-termil domain (CTD) of the largest R polymerase II subunit. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cyclin T1 (2 products)

Catalog No. Species Pres. Purity   Source  

Cyclin T1

Cyclin T1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Cyclin T1

Cyclin T1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Cyclin T1 (1 products)

Catalog No. Species Pres. Purity   Source  

CCNT1 293T Cell Transient Overexpression Lysate(Denatured)

CCNT1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn