discontinued

TA330394 RGS3 antibody

Rabbit Polyclonal Anti-RGS3 Antibody

See related secondary antibodies

Search for all "RGS3"

Quick Overview

Rabbit anti Human RGS3

Product Description for RGS3

Rabbit anti Human RGS3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RGS3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RGP3, Regulator of G-protein signaling 3
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P49796
Immunogen:
The immunogen for anti-RGS3 antibody: synthetic peptide directed towards the C terminal of human RGS3. Synthetic peptide located within the following region: KDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL.
GeneID:
5998
Application WB
Background RGS3 inhibits sigl transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their ictive GDP-bound form.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RGS3 (5 products)

Catalog No. Species Pres. Purity   Source  

RGS3 (transcript variant 4)

RGS3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RGS3 (transcript variant 1)

RGS3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

RGS3 (full length, N-term HIS tag, transcript variant 5)

RGS3 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

RGS3

RGS3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RGS3

RGS3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RGS3 (5 products)

Catalog No. Species Pres. Purity   Source  

RGS3 293T Cell Transient Overexpression Lysate(Denatured)

RGS3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

RGS3 Lysate

Western Blot: RGS3 Lysate [NBL1-15330] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RGS3
  Novus Biologicals Inc.

RGS3 Lysate

Western Blot: RGS3 Lysate [NBL1-15331] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RGS3
  Novus Biologicals Inc.

RGS3 Lysate

Western Blot: RGS3 Lysate [NBL1-15332] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RGS3
  Novus Biologicals Inc.

RGS3 Lysate

Western Blot: RGS3 Lysate [NBL1-15333] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RGS3
  Novus Biologicals Inc.
  • LinkedIn