TA330434 GABRA2 antibody

Rabbit Polyclonal Anti-GABRA2 Antibody

See related secondary antibodies

Search for all "GABRA2"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GABRA2

Product Description for GABRA2

Rabbit anti Human GABRA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GABRA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GABA A receptor subunit alpha-2, GABRA-2, Gamma-aminobutyric acid receptor subunit alpha-2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P47869
Immunogen:
The immunogen for anti-GABRA2 antibody: synthetic peptide directed towards the middle region of human GABRA2. Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ.
GeneID:
2555
Application WB
Background GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neurol inhibition by binding to the gaba/benzodiazepine receptor and opening an integral chloride channel.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn