TA330438 GABRG2 antibody

Rabbit Polyclonal Anti-GABRG2 Antibody

See related secondary antibodies

Search for all "GABRG2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human GABRG2

Product Description for GABRG2

Rabbit anti Human GABRG2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GABRG2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GABA A Receptor subunit gamma-2, GABRG-2, Gamma-aminobutyric acid receptor subunit gamma-2
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P18507
Immunogen:
The immunogen for anti-GABRG2 antibody: synthetic peptide directed towards the N terminal of human GABRG2. Synthetic peptide located within the following region: GFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVILNNLLEGYDNKLRPDI.
GeneID:
2566
Application WB
Background GABRG2 is a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene have been associated with epilepsy and febrile seizures. Multiple transcript variants encoding different isoforms have been identified for this gene.This gene encodes a gamma-aminobutyric acid (GABA) receptor. GABA is the major inhibitory neurotransmitter in the mammlian brain, where it acts at GABA-A receptors, which are ligand-gated chloride channels. GABA-A receptors are pentameric, consisting of proteins from several subunit classes: alpha, beta, gamma, delta and rho. Mutations in this gene have been associated with epilepsy and febrile seizures. Multiple transcript variants encoding different isoforms have been identified for this gene.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for GABRG2 (4 products)

Catalog No. Species Pres. Purity   Source  

GABA A Receptor gamma 2 Lysate

Western Blot: GABA A Receptor gamma 2 Lysate [NBL1-10926] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GABRG2
  Novus Biologicals Inc.

GABRG2 overexpression lysate

GABRG2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

GABRG2 overexpression lysate

GABRG2 overexpression lysate
  OriGene Technologies, Inc.

GABRG2 overexpression lysate

GABRG2 overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn