TA330470 RNF122 (Center) antibody

Rabbit Polyclonal Anti-Rnf122 Antibody

See related secondary antibodies

Search for all "RNF122"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse RNF122

Product Description for RNF122

Rabbit anti Human, Mouse RNF122.
Properties: (Center)
Presentation: Aff - Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF122

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RING finger protein 122
Presentation Aff - Purified
Reactivity Hu, Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Molecular weight RNF122: 17 kDA
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8BP31
Immunogen:
Synthetic peptide corresponding to the middle region of mouse RNF122
AA Sequence:
SLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKG
GeneID:
68867
Property Center
Application

Western blotting (0.2 - 1 µg/ml).

Background RING finger protein RNF122 has been described as a new ubiquitin ligase that can ubiquitinate itself and undergoes degradation in a RING finger-dependent manner. It interacts with CAML, and its E3 ubiquitin ligase activity was noted to be dependent on the RING finger domain.
General Readings "RNF122: A novel ubiquitin ligase associated with calcium-modulating cyclophilin ligand" Peng et al. BMC Cell Biology 2010, 11:41
Storage Store undiluted at 2-8°C for one month or (in aliquots) at -20°C to -80°C for longer.
Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Format
Purification:
Immunoaffinity column
State:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Aff - Purified
Species Reactivity
Species reactivity (tested):
Mouse, human.

Accessory Products

  • LinkedIn