TA330474 TRIM45 / RNF99 antibody

Rabbit Polyclonal Anti-TRIM45 Antibody

See related secondary antibodies

Search for all "TRIM45 / RNF99"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TRIM45 / RNF99

Product Description for TRIM45 / RNF99

Rabbit anti Human TRIM45 / RNF99.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM45 / RNF99

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RING finger protein 99, Tripartite motif-containing protein 45
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H8W5
Immunogen:
The immunogen for anti-TRIM45 antibody: synthetic peptide directed towards the middle region of human TRIM45. Synthetic peptide located within the following region: EVDPAKCVLQGEDLHRAREKQTASFTLLCKDAAGEIMGRGGDNVQVAVVP.
GeneID:
80263
Application WB
Background TRIM45 is a member of the tripartite motif family. It may function as a transcriptiol repressor of the mitogen-activated protein kise pathway. Altertively spliced transcript variants have been described.TRIM45 belongs to a family of tripartite motif (TRIM) proteins that play important roles in a variety of cellular functions, including cell proliferation, differentiation, development, oncogenesis, and apoptosis (Wang et al., 2004 [PubMed 15351693]).[supplied by OMIM].
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM45 / RNF99 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM45 / RNF99

TRIM45 / RNF99 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM45 / RNF99

TRIM45 / RNF99 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRIM45 / RNF99 (3 products)

Catalog No. Species Pres. Purity   Source  

TRIM45 293T Cell Transient Overexpression Lysate(Denatured)

TRIM45 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

TRIM45 Lysate

Western Blot: TRIM45 Lysate [NBL1-17300] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRIM45
  Novus Biologicals Inc.

TRIM45 overexpression lysate

TRIM45 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn