TA330478 RNF170 antibody

Rabbit Polyclonal Anti-RNF170 Antibody

See related secondary antibodies

Search for all "RNF170"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human RNF170

Product Description for RNF170

Rabbit anti Human RNF170.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF170

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Putative LAG1-interacting protein, RING finger protein 170
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96K19
Immunogen:
The immunogen for anti-RNF170 antibody: synthetic peptide directed towards the C terminal of human RNF170. Synthetic peptide located within the following region: FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR.
GeneID:
81790
Application WB
Background RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RNF170 (4 products)

Catalog No. Species Pres. Purity   Source  

RNF170

RNF170 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF170

RNF170 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RNF170

RNF170 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RNF170

RNF170 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RNF170 (1 products)

Catalog No. Species Pres. Purity   Source  

RNF170 293T Cell Transient Overexpression Lysate(Denatured)

RNF170 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn