TA330499 TRIM43 antibody

Rabbit Polyclonal Anti-TRIM43 Antibody

See related secondary antibodies

Search for all "TRIM43"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TRIM43

Product Description for TRIM43

Rabbit anti Human TRIM43.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM43

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Tripartite motif-containing protein 43
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96BQ3
Immunogen:
The immunogen for anti-TRIM43 antibody: synthetic peptide directed towards the C terminal of human TRIM43. Synthetic peptide located within the following region: NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES.
GeneID:
129868
Application WB
Background TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM43 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM43

TRIM43 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

TRIM43

TRIM43 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for TRIM43 (2 products)

Catalog No. Species Pres. Purity   Source  

TRIM43 Lysate

Western Blot: TRIM43 Lysate [NBL1-17298] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for TRIM43
  Novus Biologicals Inc.

TRIM43 overexpression lysate

TRIM43 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn