TA330505 TRIM11 / RNF92 antibody

Rabbit Polyclonal Anti-TRIM11 Antibody

See related secondary antibodies

Search for all "TRIM11 / RNF92"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Mouse TRIM11 / RNF92

Product Description for TRIM11 / RNF92

Rabbit anti Mouse TRIM11 / RNF92.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM11 / RNF92

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms BIA1, RING finger protein 92, Tripartite motif-containing protein 11
Presentation Purified
Reactivity Ms
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99PQ2
Immunogen:
The immunogen for anti-Trim11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GSFYNSNEPAFSPLRDPPKRVGIFLDYEAGHLSFYSATDGSLLFIFPETL.
GeneID:
94091
Application WB
Background Trim11 is an E3 ubiquitin-protein ligase that promotes the degradation of insoluble ubiquitited proteins, including insoluble PAX6, poly-Gln repeat expanded HTT and poly-Ala repeat expanded ARX. Mediates PAX6 ubiquitition leading to proteasomal degradation, thereby modulating cortical neurogenesis. It may also inhibit PAX6 transcriptiol activity, possibly in part by preventing the binding of PAX6 to its consensus sequences. It may contribute to the regulation of the intracellular level of HN (humanin) or HN-containing proteins through the proteasomal degradation pathway. It mediates MED15 ubiquitition leading to proteasomal degradation. Trim11 may contribute to the inte restriction of retroviruses. Upon overexpression, reduces HIV-1 and murine leukemia virus infectivity, by suppressing viral gene expression. Antiviral activity depends on a functiol E3 ubiquitin-protein ligase domain. Trim11 may regulate TRIM5 turnover via the proteasome pathway, thus counteracting the TRIM5-mediated cross-species restriction of retroviral infection at early stages of the retroviral life cycle.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn