TA330508 RNF165 antibody

Rabbit Polyclonal Anti-RNF165 Antibody

See related secondary antibodies

Search for all "RNF165"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human RNF165

Product Description for RNF165

Rabbit anti Human RNF165.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RNF165

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms RING finger protein 165
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6ZSG1
Immunogen:
The immunogen for anti-RNF165 antibody: synthetic peptide directed towards the N terminal of human RNF165. Synthetic peptide located within the following region: MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP.
GeneID:
494470
Application WB
Background RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.Encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.
Format
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn